Lineage for d3buja_ (3buj A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278117Species Micromonospora echinospora [TaxId:1877] [195245] (1 PDB entry)
  8. 1278118Domain d3buja_: 3buj A: [195246]
    automated match to d3ejbd_
    complexed with hem

Details for d3buja_

PDB Entry: 3buj (more details), 2.47 Å

PDB Description: crystal structure of calo2
PDB Compounds: (A:) CalO2

SCOPe Domain Sequences for d3buja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buja_ a.104.1.0 (A:) automated matches {Micromonospora echinospora [TaxId: 1877]}
vtafdptdadvrrdpypsyhwllrhdpvhrgahrvwyvsrfadvravlgderfartgirr
fwtdlvgpgllaeivgdiilfqdepdhgrlrgvvgpafspsalrrlepviagtvddllrp
alargamdvvdelayplalravlgllglpaadwgavgrwsrdvgrtldrgasaedmrrgh
aaiaefadyveralarrrreggedllalmldahdrglmsrneivstvvtfiftghetvas
qvgnavlsllahpdqldllrrrpdllaqaveeclrydpsvqsntrqldvdvelrgrrlrr
ddvvvvlagaanrdprrydrpddfdierdpvpsmsfgagmryclgsylartqlraavaal
arlpglrlgcasdalayqprtmfrglaslpiaftpgg

SCOPe Domain Coordinates for d3buja_:

Click to download the PDB-style file with coordinates for d3buja_.
(The format of our PDB-style files is described here.)

Timeline for d3buja_: