Lineage for d3buja1 (3buj A:2-397)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005700Species Micromonospora echinospora [TaxId:1877] [195245] (1 PDB entry)
  8. 2005701Domain d3buja1: 3buj A:2-397 [195246]
    Other proteins in same PDB: d3buja2
    automated match to d3ejbd_
    complexed with hem

Details for d3buja1

PDB Entry: 3buj (more details), 2.47 Å

PDB Description: crystal structure of calo2
PDB Compounds: (A:) CalO2

SCOPe Domain Sequences for d3buja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3buja1 a.104.1.0 (A:2-397) automated matches {Micromonospora echinospora [TaxId: 1877]}
tafdptdadvrrdpypsyhwllrhdpvhrgahrvwyvsrfadvravlgderfartgirrf
wtdlvgpgllaeivgdiilfqdepdhgrlrgvvgpafspsalrrlepviagtvddllrpa
largamdvvdelayplalravlgllglpaadwgavgrwsrdvgrtldrgasaedmrrgha
aiaefadyveralarrrreggedllalmldahdrglmsrneivstvvtfiftghetvasq
vgnavlsllahpdqldllrrrpdllaqaveeclrydpsvqsntrqldvdvelrgrrlrrd
dvvvvlagaanrdprrydrpddfdierdpvpsmsfgagmryclgsylartqlraavaala
rlpglrlgcasdalayqprtmfrglaslpiaftpgg

SCOPe Domain Coordinates for d3buja1:

Click to download the PDB-style file with coordinates for d3buja1.
(The format of our PDB-style files is described here.)

Timeline for d3buja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3buja2