Lineage for d2yv8a_ (2yv8 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1534620Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1534621Protein automated matches [190437] (29 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187655] (38 PDB entries)
  8. 1534782Domain d2yv8a_: 2yv8 A: [195244]
    automated match to d3ap5a_

Details for d2yv8a_

PDB Entry: 2yv8 (more details), 1.92 Å

PDB Description: Crystal structure of N-terminal domain of human galectin-8
PDB Compounds: (A:) Galectin-8 variant

SCOPe Domain Sequences for d2yv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yv8a_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsgpssg

SCOPe Domain Coordinates for d2yv8a_:

Click to download the PDB-style file with coordinates for d2yv8a_.
(The format of our PDB-style files is described here.)

Timeline for d2yv8a_: