SCOPe 2.08: Domain d2yv8a1: 2yv8 A:14-158

Lineage for d2yv8a1 (2yv8 A:14-158)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d2yv8a1: 2yv8 A:14-158 [195244]
   Other proteins in same PDB: d2yv8a2
   automated match to d3ap5a_

Details for d2yv8a1

PDB Entry: 2yv8, 1.92 Å

PDB Description: Crystal structure of N-terminal domain of human galectin-8

PDB Compounds: (A:) Galectin-8 variant

SCOPe Domain Sequences for d2yv8a1:

Sequence; same for both SEQRES and ATOM records:

>d2yv8a1 b.29.1.0 (A:14-158) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigf

Timeline for d2yv8a1:

• d2yv8a1 first appeared in SCOPe 2.02, called d2yv8a_
  
• d2yv8a1 appears in SCOPe 2.07