Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
Domain d2yv8a1: 2yv8 A:14-158 [195244] Other proteins in same PDB: d2yv8a2 automated match to d3ap5a_ |
PDB Entry: 2yv8 (more details), 1.92 Å
SCOPe Domain Sequences for d2yv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yv8a1 b.29.1.0 (A:14-158) automated matches {Human (Homo sapiens) [TaxId: 9606]} nlqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhf nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly ghrigpekidtlgiygkvnihsigf
Timeline for d2yv8a1: