![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
![]() | Protein automated matches [190183] (10 species) not a true protein |
![]() | Species Dengue virus [TaxId:12637] [195242] (1 PDB entry) |
![]() | Domain d4al8c_: 4al8 C: [195243] Other proteins in same PDB: d4al8h_, d4al8l1, d4al8l2 automated match to d2jsfa1 complexed with gol |
PDB Entry: 4al8 (more details), 1.66 Å
SCOPe Domain Sequences for d4al8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4al8c_ b.1.18.4 (C:) automated matches {Dengue virus [TaxId: 12637]} syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi vtdkekpvnieaeppfgesyivvgagekalklswfkkg
Timeline for d4al8c_: