Lineage for d4al8c_ (4al8 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765451Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2765495Protein automated matches [190183] (10 species)
    not a true protein
  7. 2765510Species Dengue virus [TaxId:12637] [195242] (1 PDB entry)
  8. 2765511Domain d4al8c_: 4al8 C: [195243]
    Other proteins in same PDB: d4al8h_, d4al8l1, d4al8l2
    automated match to d2jsfa1
    complexed with gol

Details for d4al8c_

PDB Entry: 4al8 (more details), 1.66 Å

PDB Description: Structure of Dengue virus DIII in complex with Fab 2H12
PDB Compounds: (C:) envelope protein

SCOPe Domain Sequences for d4al8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4al8c_ b.1.18.4 (C:) automated matches {Dengue virus [TaxId: 12637]}
syvmctgsfklekevaetqhgtvlvqvkyegtdapckipfssqdekgvtqngrlitanpi
vtdkekpvnieaeppfgesyivvgagekalklswfkkg

SCOPe Domain Coordinates for d4al8c_:

Click to download the PDB-style file with coordinates for d4al8c_.
(The format of our PDB-style files is described here.)

Timeline for d4al8c_: