![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
![]() | Protein automated matches [190183] (7 species) not a true protein |
![]() | Species Dengue virus 3 [TaxId:11069] [195240] (2 PDB entries) |
![]() | Domain d4alac_: 4ala C: [195241] Other proteins in same PDB: d4alal1, d4alal2 automated match to d2jsfa1 complexed with gol |
PDB Entry: 4ala (more details), 1.84 Å
SCOPe Domain Sequences for d4alac_:
Sequence, based on SEQRES records: (download)
>d4alac_ b.1.18.4 (C:) automated matches {Dengue virus 3 [TaxId: 11069]} amclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanpvvt kkeepvnieaeppfgesnivigigdkalkinw
>d4alac_ b.1.18.4 (C:) automated matches {Dengue virus 3 [TaxId: 11069]} amclntfvlkkevsetqhgtilikveykgedapckipfstrlitanpvvtkkeepvniea eppfgnivigikalkinw
Timeline for d4alac_: