Lineage for d1pp2r_ (1pp2 R:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6695Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 6696Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) (S)
  5. 6701Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 6765Protein Snake phospholipase A2 [48624] (12 species)
  7. 6825Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [48627] (1 PDB entry)
  8. 6827Domain d1pp2r_: 1pp2 R: [19524]

Details for d1pp2r_

PDB Entry: 1pp2 (more details), 2.5 Å

PDB Description: the refined crystal structure of dimeric phospholipase a2 at 2.5 angstroms. access to a shielded catalytic center

SCOP Domain Sequences for d1pp2r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp2r_ a.133.1.2 (R:) Snake phospholipase A2 {Western diamondback rattlesnake (Crotalus atrox)}
slvqfetlimkiagrsgllwysaygcycgwgghglpqdatdrccfvhdccygkatdcnpk
tvsytyseengeiicggddpcgtqicecdkaaaicfrdnipsydnkywlfppkdcreepe
pc

SCOP Domain Coordinates for d1pp2r_:

Click to download the PDB-style file with coordinates for d1pp2r_.
(The format of our PDB-style files is described here.)

Timeline for d1pp2r_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pp2l_