Lineage for d4erub_ (4eru B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703802Family a.25.1.4: YciF-like [140445] (3 proteins)
    Pfam PF05974; DUF892
  6. 2703811Protein automated matches [195225] (1 species)
    not a true protein
  7. 2703812Species Salmonella enterica [TaxId:588858] [195226] (1 PDB entry)
  8. 2703814Domain d4erub_: 4eru B: [195227]
    Other proteins in same PDB: d4erua2
    automated match to d2gs4a1
    complexed with mg, mlt

Details for d4erub_

PDB Entry: 4eru (more details), 2.1 Å

PDB Description: Crystal Structure of Putative Cytoplasmic Protein, YciF Bacterial Stress Response Protein from Salmonella enterica
PDB Compounds: (B:) YciF Bacterial Stress Response Protein

SCOPe Domain Sequences for d4erub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4erub_ a.25.1.4 (B:) automated matches {Salmonella enterica [TaxId: 588858]}
mniktvedlfihllsdtysaekqltkalpklaratsneklsqafqshleetqgqieridq
ivesesgiklkrmkcvameglieeaneviesteknevrdaaliaaaqkvehyeiasygtl
atlaeqlgyskalkllketldeekqtdlkltdlavsnv

SCOPe Domain Coordinates for d4erub_:

Click to download the PDB-style file with coordinates for d4erub_.
(The format of our PDB-style files is described here.)

Timeline for d4erub_: