Lineage for d1a3fb_ (1a3f B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51243Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 51244Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 51249Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 51319Protein Snake phospholipase A2 [48624] (12 species)
  7. 51350Species Indian cobra (Naja naja naja) [48626] (3 PDB entries)
  8. 51356Domain d1a3fb_: 1a3f B: [19522]

Details for d1a3fb_

PDB Entry: 1a3f (more details), 2.65 Å

PDB Description: phospholipase a2 (pla2) from naja naja venom

SCOP Domain Sequences for d1a3fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3fb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian cobra (Naja naja naja)}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOP Domain Coordinates for d1a3fb_:

Click to download the PDB-style file with coordinates for d1a3fb_.
(The format of our PDB-style files is described here.)

Timeline for d1a3fb_: