Lineage for d3s9oc_ (3s9o C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700417Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 2700418Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 2700440Protein automated matches [190364] (2 species)
    not a true protein
  7. 2700441Species Human (Homo sapiens) [TaxId:9606] [187198] (4 PDB entries)
  8. 2700448Domain d3s9oc_: 3s9o C: [195212]
    automated match to d1k04a_
    complexed with cl, na

Details for d3s9oc_

PDB Entry: 3s9o (more details), 2.6 Å

PDB Description: The Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase showing N-terminal interactions in cis
PDB Compounds: (C:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3s9oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s9oc_ a.24.14.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllat
vdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaahal
avdaknlldvidqarlkmlgq

SCOPe Domain Coordinates for d3s9oc_:

Click to download the PDB-style file with coordinates for d3s9oc_.
(The format of our PDB-style files is described here.)

Timeline for d3s9oc_: