Lineage for d4a6wa_ (4a6w A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581092Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2581093Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2581094Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2581230Protein automated matches [195197] (7 species)
    not a true protein
  7. 2581233Species Escherichia coli [TaxId:469008] [195208] (1 PDB entry)
  8. 2581234Domain d4a6wa_: 4a6w A: [195209]
    automated match to d4mata_
    complexed with 5c1, mn

Details for d4a6wa_

PDB Entry: 4a6w (more details), 1.46 Å

PDB Description: X-ray structures of oxazole hydroxamate EcMetAp-Mn complexes
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d4a6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6wa_ d.127.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

SCOPe Domain Coordinates for d4a6wa_:

Click to download the PDB-style file with coordinates for d4a6wa_.
(The format of our PDB-style files is described here.)

Timeline for d4a6wa_: