Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein automated matches [195197] (4 species) not a true protein |
Species Escherichia coli [TaxId:469008] [195208] (1 PDB entry) |
Domain d4a6wa_: 4a6w A: [195209] automated match to d4mata_ complexed with 5c1, mn |
PDB Entry: 4a6w (more details), 1.46 Å
SCOPe Domain Sequences for d4a6wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6wa_ d.127.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]} aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt dngceiltlrkddtipaiishd
Timeline for d4a6wa_: