SCOPe 2.06: Domain d4a6wa_: 4a6w A:

Lineage for d4a6wa_ (4a6w A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [195208] (1 PDB entry)

8. Domain d4a6wa_: 4a6w A: [195209]
   automated match to d4mata_
   complexed with 5c1, mn

Details for d4a6wa_

PDB Entry: 4a6w, 1.46 Å

PDB Description: X-ray structures of oxazole hydroxamate EcMetAp-Mn complexes

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d4a6wa_:

Sequence; same for both SEQRES and ATOM records:

>d4a6wa_ d.127.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigqgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

Timeline for d4a6wa_:

• d4a6wa_ first appeared in SCOPe 2.02
  
• d4a6wa_ appears in SCOPe 2.05
  
• d4a6wa_ appears in SCOPe 2.07
  
• d4a6wa_ appears in the current release, SCOPe 2.08