Lineage for d2yjtc_ (2yjt C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851428Superfamily c.8.7: RraA-like [89562] (2 families) (S)
    structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase
  5. 2851429Family c.8.7.1: RraA-like [89563] (5 proteins)
    aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
    automatically mapped to Pfam PF03737
  6. 2851451Protein automated matches [195200] (1 species)
    not a true protein
  7. 2851452Species Escherichia coli K-12 [TaxId:83333] [195201] (1 PDB entry)
  8. 2851455Domain d2yjtc_: 2yjt C: [195207]
    Other proteins in same PDB: d2yjtd_
    automated match to d1q5xa_
    protein/RNA complex

Details for d2yjtc_

PDB Entry: 2yjt (more details), 2.9 Å

PDB Description: crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
PDB Compounds: (C:) Regulator of ribonuclease activity A

SCOPe Domain Sequences for d2yjtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjtc_ c.8.7.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsedpld

SCOPe Domain Coordinates for d2yjtc_:

Click to download the PDB-style file with coordinates for d2yjtc_.
(The format of our PDB-style files is described here.)

Timeline for d2yjtc_: