Lineage for d3vk1a_ (3vk1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2546828Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2547260Protein automated matches [190406] (22 species)
    not a true protein
  7. 2547402Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)
  8. 2547419Domain d3vk1a_: 3vk1 A: [195205]
    automated match to d2p4md_
    complexed with cl, iod

Details for d3vk1a_

PDB Entry: 3vk1 (more details), 2.2 Å

PDB Description: green-fluorescent variant of the non-fluorescent chromoprotein rtms5
PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d3vk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk1a_ d.22.1.1 (A:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
viatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspqcx
sipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsgln
fppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykakkpvk
mpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d3vk1a_:

Click to download the PDB-style file with coordinates for d3vk1a_.
(The format of our PDB-style files is described here.)

Timeline for d3vk1a_: