SCOPe 2.05: Domain d3vk1a_: 3vk1 A:

Lineage for d3vk1a_ (3vk1 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)

8. Domain d3vk1a_: 3vk1 A: [195205]
   automated match to d2p4md_
   complexed with cl, iod

Details for d3vk1a_

PDB Entry: 3vk1, 2.2 Å

PDB Description: green-fluorescent variant of the non-fluorescent chromoprotein rtms5

PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d3vk1a_:

Sequence; same for both SEQRES and ATOM records:

>d3vk1a_ d.22.1.1 (A:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
viatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspqcx
sipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsgln
fppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykakkpvk
mpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

Timeline for d3vk1a_:

• d3vk1a_ first appeared in SCOPe 2.02
  
• d3vk1a_ appears in SCOPe 2.04
  
• d3vk1a_ appears in SCOPe 2.06
  
• d3vk1a_ appears in the current release, SCOPe 2.08