SCOPe 2.08: Domain d2yjtb_: 2yjt B:

Lineage for d2yjtb_ (2yjt B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.7: RraA-like [89562] (2 families)
   structural similarity and possible distant homology to the phosphohistidine domain of pyruvate phosphate dikinase

5. Family c.8.7.1: RraA-like [89563] (5 proteins)
   aka MenG-like; characterized as regulator of RNase E activity A (RraA) that globally modulates RNA abundance in E. coli
   automatically mapped to Pfam PF03737

6. Protein automated matches [195200] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [195201] (1 PDB entry)

8. Domain d2yjtb_: 2yjt B: [195202]
   Other proteins in same PDB: d2yjtd_
   automated match to d1q5xa_
   protein/RNA complex

Details for d2yjtb_

PDB Entry: 2yjt, 2.9 Å

PDB Description: crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)

PDB Compounds: (B:) Regulator of ribonuclease activity A

SCOPe Domain Sequences for d2yjtb_:

Sequence; same for both SEQRES and ATOM records:

>d2yjtb_ c.8.7.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kydtselcdiyqedvnvveplfsnfggrasfggqiitvkcfedngllydlleqngrgrvl
vvdgggsvrralvdaelarlavqneweglviygavrqvddleeldigiqamaaipvgaag
egigesdvrvnfggvtffsgdhlyadntgiilsedpld

Timeline for d2yjtb_:

• d2yjtb_ first appeared in SCOPe 2.02
  
• d2yjtb_ appears in SCOPe 2.07