Lineage for d1pshc_ (1psh C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346169Species Indian cobra (Naja naja) [TaxId:35670] [48626] (3 PDB entries)
  8. 2346173Domain d1pshc_: 1psh C: [19520]
    complexed with ca

Details for d1pshc_

PDB Entry: 1psh (more details), 2.3 Å

PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association
PDB Compounds: (C:) phospholipase a2

SCOPe Domain Sequences for d1pshc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pshc_ a.133.1.2 (C:) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d1pshc_:

Click to download the PDB-style file with coordinates for d1pshc_.
(The format of our PDB-style files is described here.)

Timeline for d1pshc_: