SCOP 1.73: Domain d1pshc_: 1psh C:

Lineage for d1pshc_ (1psh C:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian cobra (Naja naja) [TaxId:35670] [48626] (4 PDB entries)

8. Domain d1pshc_: 1psh C: [19520]
   complexed with ca

Details for d1pshc_

PDB Entry: 1psh, 2.3 Å

PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association

PDB Compounds: (C:) phospholipase a2

SCOP Domain Sequences for d1pshc_:

Sequence; same for both SEQRES and ATOM records:

>d1pshc_ a.133.1.2 (C:) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d1pshc_:

• d1pshc_ first appeared (with stable ids) in SCOP 1.55
  
• d1pshc_ appears in SCOP 1.71
  
• d1pshc_ appears in SCOP 1.75
  
• d1pshc_ appears in the current release, SCOPe 2.08