Lineage for d1pshc_ (1psh C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361220Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 361221Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 361226Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 361305Protein Snake phospholipase A2 [48624] (33 species)
  7. 361351Species Indian cobra (Naja naja naja) [48626] (3 PDB entries)
  8. 361355Domain d1pshc_: 1psh C: [19520]
    complexed with ca

Details for d1pshc_

PDB Entry: 1psh (more details), 2.3 Å

PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association

SCOP Domain Sequences for d1pshc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pshc_ a.133.1.2 (C:) Snake phospholipase A2 {Indian cobra (Naja naja naja)}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOP Domain Coordinates for d1pshc_:

Click to download the PDB-style file with coordinates for d1pshc_.
(The format of our PDB-style files is described here.)

Timeline for d1pshc_: