![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
![]() | Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) ![]() |
![]() | Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
![]() | Protein Methionine aminopeptidase [55924] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [55925] (32 PDB entries) Uniprot P07906 |
![]() | Domain d4a6va1: 4a6v A:2-264 [195199] Other proteins in same PDB: d4a6va2 automated match to d2ggca_ complexed with co3, iky, mn |
PDB Entry: 4a6v (more details), 1.46 Å
SCOPe Domain Sequences for d4a6va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a6va1 d.127.1.1 (A:2-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt dngceiltlrkddtipaiishde
Timeline for d4a6va1: