Lineage for d4a6va1 (4a6v A:2-264)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974624Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2974649Domain d4a6va1: 4a6v A:2-264 [195199]
    Other proteins in same PDB: d4a6va2
    automated match to d2ggca_
    complexed with co3, iky, mn

Details for d4a6va1

PDB Entry: 4a6v (more details), 1.46 Å

PDB Description: x-ray structures of oxazole hydroxamate ecmetap-mn complexes
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d4a6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4a6va1 d.127.1.1 (A:2-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishde

SCOPe Domain Coordinates for d4a6va1:

Click to download the PDB-style file with coordinates for d4a6va1.
(The format of our PDB-style files is described here.)

Timeline for d4a6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4a6va2
View in 3D
Domains from other chains:
(mouse over for more information)
d4a6vb_