Lineage for d4aiia_ (4aii A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868684Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries)
  8. 2868690Domain d4aiia_: 4aii A: [195194]
    automated match to d3q85a_
    complexed with gdp, mg

Details for d4aiia_

PDB Entry: 4aii (more details), 2.66 Å

PDB Description: Crystal structure of the rat REM2 GTPase - G domain bound to GDP
PDB Compounds: (A:) GTP-binding protein REM 2

SCOPe Domain Sequences for d4aiia_:

Sequence, based on SEQRES records: (download)

>d4aiia_ c.37.1.8 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dgvfkvmllgesgvgkstlagtfgglqgdnahemensedtyerrimvdkeevtlivydiw
eqgdaggwlqdhclqtgdaflivfsvtdrrsfskvpetllrlragrphhdlpvilvgnks
dlarsrevsleegrhlagtlsckhietsaalhhntrelfegavrqirlrr

Sequence, based on observed residues (ATOM records): (download)

>d4aiia_ c.37.1.8 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dgvfkvmllgesgvgkstlagtfgdtyerrimvdkeevtlivyddhclqtgdaflivfsv
tdrrsfskvpetllrlragrphhdlpvilvgnksdlarsrevsleegrhlagtlsckhie
tsaalhhntrelfegavrqirlrr

SCOPe Domain Coordinates for d4aiia_:

Click to download the PDB-style file with coordinates for d4aiia_.
(The format of our PDB-style files is described here.)

Timeline for d4aiia_: