Lineage for d1pshb_ (1psh B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51243Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
  4. 51244Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 51249Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins)
  6. 51319Protein Snake phospholipase A2 [48624] (12 species)
  7. 51350Species Indian cobra (Naja naja naja) [48626] (3 PDB entries)
  8. 51353Domain d1pshb_: 1psh B: [19519]

Details for d1pshb_

PDB Entry: 1psh (more details), 2.3 Å

PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association

SCOP Domain Sequences for d1pshb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pshb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian cobra (Naja naja naja)}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOP Domain Coordinates for d1pshb_:

Click to download the PDB-style file with coordinates for d1pshb_.
(The format of our PDB-style files is described here.)

Timeline for d1pshb_: