Lineage for d1pshb_ (1psh B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (2 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) Protein Snake phospholipase A2 [48624] (12 species) 
Species Indian cobra (Naja naja naja) [48626] (3 PDB entries) 
Domain d1pshb_: 1psh B: [19519]
Details for d1pshb_
PDB Entry: 1psh (more details), 2.3 Å
PDB Description: crystal structure of phospholipase a2 from indian cobra reveals a trimeric association
SCOP Domain Sequences for d1pshb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pshb_ a.133.1.2 (B:) Snake phospholipase A2 {Indian cobra (Naja naja naja)}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq
SCOP Domain Coordinates for d1pshb_:
Click to download the PDB-style file with coordinates for d1pshb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pshb_:
- d1pshb_ appears in SCOP 1.57
- d1pshb_ appears in the current release, SCOPe 2.08
View in 3D
