SCOPe 2.02: Domain d3b0kb_: 3b0k B:

Lineage for d3b0kb_ (3b0k B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)

8. Domain d3b0kb_: 3b0k B: [195186]
   automated match to d1fkqa_
   complexed with ca

Details for d3b0kb_

PDB Entry: 3b0k, 1.6 Å

PDB Description: Crystal structure of alpha-lactalbumin

PDB Compounds: (B:) alpha-lactalbumin

SCOPe Domain Sequences for d3b0kb_:

Sequence; same for both SEQRES and ATOM records:

>d3b0kb_ d.2.1.2 (B:) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
mqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc

Timeline for d3b0kb_:

• d3b0kb_ is new in SCOPe 2.02-stable
  
• d3b0kb_ appears in SCOPe 2.03
  
• d3b0kb_ appears in the current release, SCOPe 2.08, called d3b0kb1