SCOPe 2.06: Domain d4dcfa_: 4dcf A:

Lineage for d4dcfa_ (4dcf A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries)

8. Domain d4dcfa_: 4dcf A: [195185]
   automated match to d1xxsa_
   complexed with pg4

Details for d4dcfa_

PDB Entry: 4dcf, 2.7 Å

PDB Description: Structure of MTX-II from Bothrops brazili

PDB Compounds: (A:) MTX-II chain A

SCOPe Domain Sequences for d4dcfa_:

Sequence; same for both SEQRES and ATOM records:

>d4dcfa_ a.133.1.2 (A:) automated matches {Bothrops brazili [TaxId: 157546]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltdcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrnnhlkpfckkad
pc

Timeline for d4dcfa_:

• d4dcfa_ first appeared in SCOPe 2.02
  
• d4dcfa_ appears in SCOPe 2.05
  
• d4dcfa_ appears in SCOPe 2.07
  
• d4dcfa_ appears in the current release, SCOPe 2.08