Lineage for d4dcfb_ (4dcf B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099130Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1099131Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1099136Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 1099484Protein automated matches [190139] (25 species)
    not a true protein
  7. 1099487Species Bothrops brazili [TaxId:157546] [195180] (1 PDB entry)
  8. 1099489Domain d4dcfb_: 4dcf B: [195183]
    automated match to d1xxsa_
    complexed with pg4

Details for d4dcfb_

PDB Entry: 4dcf (more details), 2.7 Å

PDB Description: Structure of MTX-II from Bothrops brazili
PDB Compounds: (B:) MTX-II chain A

SCOPe Domain Sequences for d4dcfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dcfb_ a.133.1.2 (B:) automated matches {Bothrops brazili [TaxId: 157546]}
slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltdcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrnnhlkpfckkad
pc

SCOPe Domain Coordinates for d4dcfb_:

Click to download the PDB-style file with coordinates for d4dcfb_.
(The format of our PDB-style files is described here.)

Timeline for d4dcfb_: