![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Bothrops brazili [TaxId:157546] [195180] (2 PDB entries) |
![]() | Domain d4dcfc_: 4dcf C: [195181] automated match to d1xxsa_ complexed with pg4 |
PDB Entry: 4dcf (more details), 2.7 Å
SCOPe Domain Sequences for d4dcfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dcfc_ a.133.1.2 (C:) automated matches {Bothrops brazili [TaxId: 157546]} slvelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltdcdpk kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrnnhlkpfckkad pc
Timeline for d4dcfc_: