SCOPe 2.06: Domain d3b0ia1: 3b0i A:1-120

Lineage for d3b0ia1 (3b0i A:1-120)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)

8. Domain d3b0ia1: 3b0i A:1-120 [195179]
   Other proteins in same PDB: d3b0ia2
   automated match to d1hmla_
   complexed with ca, so4

Details for d3b0ia1

PDB Entry: 3b0i, 1.8 Å

PDB Description: Crystal structure of recombinant human alpha lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d3b0ia1:

Sequence; same for both SEQRES and ATOM records:

>d3b0ia1 d.2.1.2 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc

Timeline for d3b0ia1:

• d3b0ia1 first appeared in SCOPe 2.02, called d3b0ia_
  
• d3b0ia1 was called d3b0ia_ in SCOPe 2.05
  
• d3b0ia1 appears in SCOPe 2.07
  
• d3b0ia1 appears in the current release, SCOPe 2.08