![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
![]() | Protein automated matches [190299] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries) |
![]() | Domain d3b0ia1: 3b0i A:1-120 [195179] Other proteins in same PDB: d3b0ia2 automated match to d1hmla_ complexed with ca, so4 |
PDB Entry: 3b0i (more details), 1.8 Å
SCOPe Domain Sequences for d3b0ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b0ia1 d.2.1.2 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]} kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc
Timeline for d3b0ia1: