Lineage for d3b0ia1 (3b0i A:1-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2925556Protein automated matches [190299] (8 species)
    not a true protein
  7. 2925627Species Human (Homo sapiens) [TaxId:9606] [188701] (6 PDB entries)
  8. 2925633Domain d3b0ia1: 3b0i A:1-120 [195179]
    Other proteins in same PDB: d3b0ia2
    automated match to d1hmla_
    complexed with ca, so4

Details for d3b0ia1

PDB Entry: 3b0i (more details), 1.8 Å

PDB Description: Crystal structure of recombinant human alpha lactalbumin
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d3b0ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b0ia1 d.2.1.2 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqftkcelsqllkdidgyggialpelictmfhtsgydtqaivennesteyglfqisnklw
ckssqvpqsrnicdiscdkflddditddimcakkildikgidywlahkalctekleqwlc

SCOPe Domain Coordinates for d3b0ia1:

Click to download the PDB-style file with coordinates for d3b0ia1.
(The format of our PDB-style files is described here.)

Timeline for d3b0ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3b0ia2