SCOPe 2.08: Domain d4dtgk1: 4dtg K:2-60

Lineage for d4dtgk1 (4dtg K:2-60)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)

8. Domain d4dtgk1: 4dtg K:2-60 [195176]
   Other proteins in same PDB: d4dtgh_, d4dtgk2, d4dtgl1, d4dtgl2
   automated match to d1adza_
   complexed with gol, mes, pge

Details for d4dtgk1

PDB Entry: 4dtg, 1.8 Å

PDB Description: hemostatic effect of a monoclonal antibody mab 2021 blocking the interaction between fxa and tfpi in a rabbit hemophilia model

PDB Compounds: (K:) tissue factor pathway inhibitor

SCOPe Domain Sequences for d4dtgk1:

Sequence; same for both SEQRES and ATOM records:

>d4dtgk1 g.8.1.1 (K:2-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekpdfcfleedpgicrgyitryfynnqtkqcerfkyggclgnmnnfetleecknicedg

Timeline for d4dtgk1:

• d4dtgk1 first appeared in SCOPe 2.02, called d4dtgk_
  
• d4dtgk1 appears in SCOPe 2.07