Lineage for d4duab_ (4dua B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331061Protein Cytochrome P450 bm-3 [48268] (2 species)
  7. 2331085Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2331143Domain d4duab_: 4dua B: [195170]
    automated match to d1jpza_
    complexed with hem, pge

Details for d4duab_

PDB Entry: 4dua (more details), 2 Å

PDB Description: cytochrome p450 bm3h-9d7 mri sensor, no ligand
PDB Compounds: (B:) cytochrome P450 BM3 variant 9D7

SCOPe Domain Sequences for d4duab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duab_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
kdpetgeplddeniryqiitflaagheatsgllsfalyflvknphvlqkaaeeaarvlvd
pvpsykqvkqlkyvgmvlnealrlwptgpafslyakedtvlggeyplekgdelmvlipql
hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
fdfedhtnyeldiketlvlkpegfvvkakskkiplgg

SCOPe Domain Coordinates for d4duab_:

Click to download the PDB-style file with coordinates for d4duab_.
(The format of our PDB-style files is described here.)

Timeline for d4duab_: