Lineage for d1a3da_ (1a3d A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. Protein Snake phospholipase A2 [48624] (38 species)
  7. Species Indian cobra (Naja naja) [TaxId:35670] [48626] (3 PDB entries)
  8. Domain d1a3da_: 1a3d A: [19517]
    complexed with na

Details for d1a3da_

PDB Entry: 1a3d (more details), 1.8 Å

PDB Description: phospholipase a2 (pla2) from naja naja venom
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1a3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3da_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckgdnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d1a3da_ are not available.

Timeline for d1a3da_: