Lineage for d4duca_ (4duc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005085Domain d4duca_: 4duc A: [195166]
    automated match to d1jpza_
    complexed with hem

Details for d4duca_

PDB Entry: 4duc (more details), 1.92 Å

PDB Description: cytochrome P450 BM3h-2G9 MRI sensor, no ligand
PDB Compounds: (A:) cytochrome P450 BM3 variant 2G9

SCOPe Domain Sequences for d4duca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duca_ a.104.1.1 (A:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
ikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtcylssqrlikea
cdesrfdknlsqalkfvrdfagdglltswtheknwkkahnillpsfsqqamkgyhammvd
iavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvral
deamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngk
dpetgeplddeniryqiitfliaghestsgllsfalyflvknphvlqkaaeeaarvlvdp
vpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlh
rdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhf
dfedhtnyeldiketlllkpegfvvkakskkiplgg

SCOPe Domain Coordinates for d4duca_:

Click to download the PDB-style file with coordinates for d4duca_.
(The format of our PDB-style files is described here.)

Timeline for d4duca_: