Lineage for d4eo5a_ (4eo5 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1300372Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 1300373Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1300399Protein automated matches [195145] (1 species)
    not a true protein
  7. 1300400Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [195164] (2 PDB entries)
  8. 1300402Domain d4eo5a_: 4eo5 A: [195165]
    Other proteins in same PDB: d4eo5b_, d4eo5c_
    automated match to d2huea1
    complexed with act, gol; mutant

Details for d4eo5a_

PDB Entry: 4eo5 (more details), 2.35 Å

PDB Description: Yeast Asf1 bound to H3/H4G94P mutant
PDB Compounds: (A:) histone chaperone asf1

SCOPe Domain Sequences for d4eo5a_:

Sequence, based on SEQRES records: (download)

>d4eo5a_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
elrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp

Sequence, based on observed residues (ATOM records): (download)

>d4eo5a_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
elrenppakvqvdhivrnilaekprvtrfnivwdngdlypp

SCOPe Domain Coordinates for d4eo5a_:

Click to download the PDB-style file with coordinates for d4eo5a_.
(The format of our PDB-style files is described here.)

Timeline for d4eo5a_: