SCOPe 2.03: Domain d4eo5a_: 4eo5 A:

Lineage for d4eo5a_ (4eo5 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein automated matches [195145] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [195164] (2 PDB entries)

8. Domain d4eo5a_: 4eo5 A: [195165]
   Other proteins in same PDB: d4eo5b_, d4eo5c_
   automated match to d2huea1
   complexed with act, gol; mutant

Details for d4eo5a_

PDB Entry: 4eo5, 2.35 Å

PDB Description: Yeast Asf1 bound to H3/H4G94P mutant

PDB Compounds: (A:) histone chaperone asf1

SCOPe Domain Sequences for d4eo5a_:

Sequence, based on SEQRES records:

>d4eo5a_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
elrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp

Sequence, based on observed residues (ATOM records):

>d4eo5a_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
elrenppakvqvdhivrnilaekprvtrfnivwdngdlypp

Timeline for d4eo5a_:

• d4eo5a_ first appeared in SCOPe 2.02
  
• d4eo5a_ appears in SCOPe 2.04
  
• d4eo5a_ appears in the current release, SCOPe 2.08, called d4eo5a1