Lineage for d4emkb_ (4emk B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2380450Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2380451Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2381067Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2381068Protein automated matches [190914] (13 species)
    not a true protein
  7. 2381263Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 2381289Domain d4emkb_: 4emk B: [195159]
    automated match to d3swnq_

Details for d4emkb_

PDB Entry: 4emk (more details), 2.3 Å

PDB Description: Crystal structure of SpLsm5/6/7
PDB Compounds: (B:) U6 snRNA-associated Sm-like protein LSm6

SCOPe Domain Sequences for d4emkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emkb_ b.38.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
mdsspneflnkvigkkvlirlssgvdykgilscldgymnlalerteeyvngkktnvygda
firgnnvlyvsal

SCOPe Domain Coordinates for d4emkb_:

Click to download the PDB-style file with coordinates for d4emkb_.
(The format of our PDB-style files is described here.)

Timeline for d4emkb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4emka_