Lineage for d4emgh_ (4emg H:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787219Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1787220Protein automated matches [190914] (10 species)
    not a true protein
  7. 1787349Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 1787383Domain d4emgh_: 4emg H: [195148]
    automated match to d3bw1a_

Details for d4emgh_

PDB Entry: 4emg (more details), 2.7 Å

PDB Description: Crystal structure of SpLsm3
PDB Compounds: (H:) Probable U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d4emgh_:

Sequence, based on SEQRES records: (download)

>d4emgh_ b.38.1.0 (H:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivtifddeetdkdkal
ktirkhyemlfvrgdsviliapprn

Sequence, based on observed residues (ATOM records): (download)

>d4emgh_ b.38.1.0 (H:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
epldlvrlsldeivyvklrgdrelngrlhaydehlnmvlgdaeeivttirkhyemlfvrg
dsviliapprn

SCOPe Domain Coordinates for d4emgh_:

Click to download the PDB-style file with coordinates for d4emgh_.
(The format of our PDB-style files is described here.)

Timeline for d4emgh_: