Lineage for d3c5nb_ (3c5n B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2165632Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
    beta-sheet folds into a barrel (n=12, S=12) around the central helix
  4. 2165633Superfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) (S)
  5. 2165634Family d.23.1.1: Transcriptional factor tubby, C-terminal domain [54519] (2 protein domains)
    automatically mapped to Pfam PF01167
  6. 2165639Protein automated matches [190641] (1 species)
    not a true protein
  7. 2165640Species Human (Homo sapiens) [TaxId:9606] [187711] (3 PDB entries)
  8. 2165642Domain d3c5nb_: 3c5n B: [195142]
    automated match to d2fima_
    complexed with i3p

Details for d3c5nb_

PDB Entry: 3c5n (more details), 1.8 Å

PDB Description: structure of human tulp1 in complex with ip3
PDB Compounds: (B:) Tubby-related protein 1

SCOPe Domain Sequences for d3c5nb_:

Sequence, based on SEQRES records: (download)

>d3c5nb_ d.23.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prefvlrpapqgrtvrcrltrdkkgmdrgmypsyflhldtekkvfllagrkrkrsktany
lisidptnlsrggenfigklrsnllgnrftvfdngqnpqrgystnvaslrqelaaviyet
nvlgfrgprrmtviipgmsaenervpirprnasdgllvrwqnktleslielhnkppvwnd
dsgsytlnfqgrvtqasvknfqivhaddpdyivlqfgrvaedaftldyryplcalqafai
alssfd

Sequence, based on observed residues (ATOM records): (download)

>d3c5nb_ d.23.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prefvlrpapqgrtvrcrltrdkypsyflhldtekkvfllagrkrkrsktanylisidpt
nfigklrsnllgnrftvfdngqnpqrgystnvaslrqelaaviyetnvlgfrgprrmtvi
ipgmsaenervpirprnasdgllvrwqnktleslielhnkppvlnfqgrvtqasvknfqi
vhaddpdyivlqfgrvaedaftldyryplcalqafaialssfd

SCOPe Domain Coordinates for d3c5nb_:

Click to download the PDB-style file with coordinates for d3c5nb_.
(The format of our PDB-style files is described here.)

Timeline for d3c5nb_: