Lineage for d1poaa_ (1poa A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346331Species Taiwan cobra (Naja naja atra) [TaxId:8656] [48625] (2 PDB entries)
  8. 2346332Domain d1poaa_: 1poa A: [19514]
    complexed with ca

Details for d1poaa_

PDB Entry: 1poa (more details), 1.5 Å

PDB Description: interfacial catalysis: the mechanism of phospholipase a2
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1poaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poaa_ a.133.1.2 (A:) Snake phospholipase A2 {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc

SCOPe Domain Coordinates for d1poaa_:

Click to download the PDB-style file with coordinates for d1poaa_.
(The format of our PDB-style files is described here.)

Timeline for d1poaa_: