Lineage for d1poa__ (1poa -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (4 proteins) 
Protein Snake phospholipase A2 [48624] (12 species) Species Taiwan cobra (Naja naja atra) [TaxId:8656] [48625] (2 PDB entries) 
Domain d1poa__: 1poa - [19514]
Details for d1poa__
PDB Entry: 1poa (more details), 1.5 Å
PDB Description: interfacial catalysis: the mechanism of phospholipase a2
SCOP Domain Sequences for d1poa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poa__ a.133.1.2 (-) Snake phospholipase A2 {Taiwan cobra (Naja naja atra)}
nlyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekisgc
wpyfktysyecsqgtltckggnnacaaavcdcdrlaaicfagapyndndyninlkarc
SCOP Domain Coordinates for d1poa__:
Click to download the PDB-style file with coordinates for d1poa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1poa__:
- d1poa__ first appeared (with stable ids) in SCOP 1.55
- d1poa__ appears in SCOP 1.59
- d1poa__ appears in the current release, SCOPe 2.08, called d1poaa_
View in 3D