SCOPe 2.07: Domain d3s9ua1: 3s9u A:1-162

Lineage for d3s9ua1 (3s9u A:1-162)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (27 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3s9ua1: 3s9u A:1-162 [195135]
   Other proteins in same PDB: d3s9ua2, d3s9ub2
   automated match to d3jwma_
   complexed with 5dr, nap

Details for d3s9ua1

PDB Entry: 3s9u, 1.9 Å

PDB Description: Bacillus anthracis Dihydrofolate Reductase bound to propargyl-linked TMP analog, UCP120J

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3s9ua1:

Sequence; same for both SEQRES and ATOM records:

>d3s9ua1 c.71.1.0 (A:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3s9ua1:

• d3s9ua1 first appeared in SCOPe 2.02, called d3s9ua_
  
• d3s9ua1 appears in SCOPe 2.06
  
• d3s9ua1 appears in the current release, SCOPe 2.08