Lineage for d3s9ub1 (3s9u B:1-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511492Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2511494Domain d3s9ub1: 3s9u B:1-162 [195134]
    Other proteins in same PDB: d3s9ua2, d3s9ub2
    automated match to d3jwma_
    complexed with 5dr, nap

Details for d3s9ub1

PDB Entry: 3s9u (more details), 1.9 Å

PDB Description: Bacillus anthracis Dihydrofolate Reductase bound to propargyl-linked TMP analog, UCP120J
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3s9ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s9ub1 c.71.1.0 (B:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d3s9ub1:

Click to download the PDB-style file with coordinates for d3s9ub1.
(The format of our PDB-style files is described here.)

Timeline for d3s9ub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s9ub2