SCOPe 2.05: Domain d1poca_: 1poc A:

Lineage for d1poca_ (1poc A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.1: Insect phospholipase A2 [48620] (1 protein)

6. Protein Phospholipase A2 [48621] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [48622] (1 PDB entry)

8. Domain d1poca_: 1poc A: [19513]
   complexed with ca, gel

Details for d1poca_

PDB Entry: 1poc, 2 Å

PDB Description: crystal structure of bee-venom phospholipase a2 in a complex with a transition-state analogue

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1poca_:

Sequence; same for both SEQRES and ATOM records:

>d1poca_ a.133.1.1 (A:) Phospholipase A2 {Honeybee (Apis mellifera) [TaxId: 7460]}
iiypgtlwcghgnkssgpnelgrfkhtdaccrthdmcpdvmsageskhgltntashtrls
cdcddkfydclknsadtissyfvgkmyfnlidtkcyklehpvtgcgertegrclhytvdk
skpkvyqwfdlrky

Timeline for d1poca_:

• d1poca_ first appeared (with stable ids) in SCOP 1.55, called d1poc__
  
• d1poca_ appears in SCOPe 2.04
  
• d1poca_ appears in SCOPe 2.06
  
• d1poca_ appears in the current release, SCOPe 2.08