SCOP 1.69: Domain d1poc__: 1poc -

Lineage for d1poc__ (1poc -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.1: Insect phospholipase A2 [48620] (1 protein)

6. Protein Phospholipase A2 [48621] (1 species)

7. Species European honeybee (Apis mellifera) [TaxId:7460] [48622] (1 PDB entry)

8. Domain d1poc__: 1poc - [19513]

Details for d1poc__

PDB Entry: 1poc, 2 Å

PDB Description: crystal structure of bee-venom phospholipase a2 in a complex with a transition-state analogue

SCOP Domain Sequences for d1poc__:

Sequence; same for both SEQRES and ATOM records:

>d1poc__ a.133.1.1 (-) Phospholipase A2 {European honeybee (Apis mellifera)}
iiypgtlwcghgnkssgpnelgrfkhtdaccrthdmcpdvmsageskhgltntashtrls
cdcddkfydclknsadtissyfvgkmyfnlidtkcyklehpvtgcgertegrclhytvdk
skpkvyqwfdlrky

Timeline for d1poc__:

• d1poc__ first appeared (with stable ids) in SCOP 1.55
  
• d1poc__ appears in SCOP 1.67
  
• d1poc__ appears in SCOP 1.71
  
• d1poc__ appears in the current release, SCOPe 2.08, called d1poca_