SCOPe 2.06: Domain d3saib1: 3sai B:1-162

Lineage for d3saib1 (3sai B:1-162)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d3saib1: 3sai B:1-162 [195128]
   Other proteins in same PDB: d3saia2, d3saib2
   automated match to d3jwma_
   complexed with 9dr, nap, ni, peg

Details for d3saib1

PDB Entry: 3sai, 2.25 Å

PDB Description: Bacuills anthracis Dihydrofolate Reductase bound to propargyl-linked TMP analog, UCP1015

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d3saib1:

Sequence; same for both SEQRES and ATOM records:

>d3saib1 c.71.1.0 (B:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrvsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d3saib1:

• d3saib1 first appeared in SCOPe 2.02, called d3saib_
  
• d3saib1 was called d3saib_ in SCOPe 2.05
  
• d3saib1 appears in SCOPe 2.07
  
• d3saib1 appears in the current release, SCOPe 2.08