SCOPe 2.06: Domain d3vehb1: 3veh B:1-449

Lineage for d3vehb1 (3veh B:1-449)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein Salicylate synthase MbtI [143945] (1 species)
   Mycobactin synthetase protein I

7. Species Mycobacterium tuberculosis [TaxId:1773] [143946] (9 PDB entries)
   Uniprot Q7D785 15-449

8. Domain d3vehb1: 3veh B:1-449 [195125]
   Other proteins in same PDB: d3vehb2
   automated match to d3logb_
   complexed with 0ga, gol, k, peg, scn

Details for d3vehb1

PDB Entry: 3veh, 2 Å

PDB Description: Structure of a M. tuberculosis salicylate synthase, MbtI, in complex with an inhibitor methylAMT

PDB Compounds: (B:) Isochorismate synthase/isochorismate-pyruvate lyase mbtI

SCOPe Domain Sequences for d3vehb1:

Sequence; same for both SEQRES and ATOM records:

>d3vehb1 d.161.1.1 (B:1-449) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
mselsvatgavstasssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagv
qamveldsdelrvirdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryg
lqqrlaphtplarvfsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdv
sddpsgfrrrvavavdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllq
lggiralgyspelvtavradgvviteplagtralgrgpaidrlarddlesnskeivehai
svrssleeitdiaepgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpav
tasgipkaagveaifrldecprglysgavvmlsadggldaaltlraayqvggrtwlraga
giieeseperefeetceklstltpylvar

Timeline for d3vehb1:

• d3vehb1 first appeared in SCOPe 2.02, called d3vehb_
  
• d3vehb1 was called d3vehb_ in SCOPe 2.05
  
• d3vehb1 appears in SCOPe 2.07
  
• d3vehb1 appears in the current release, SCOPe 2.08