SCOPe 2.02: Domain d3vehb_: 3veh B:

Lineage for d3vehb_ (3veh B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein automated matches [190419] (2 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [195123] (5 PDB entries)

8. Domain d3vehb_: 3veh B: [195125]
   automated match to d3logb_
   complexed with 0ga, gol, k, peg, scn

Details for d3vehb_

PDB Entry: 3veh, 2 Å

PDB Description: Structure of a M. tuberculosis salicylate synthase, MbtI, in complex with an inhibitor methylAMT

PDB Compounds: (B:) Isochorismate synthase/isochorismate-pyruvate lyase mbtI

SCOPe Domain Sequences for d3vehb_:

Sequence; same for both SEQRES and ATOM records:

>d3vehb_ d.161.1.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
gsmselsvatgavstasssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaa
gvqamveldsdelrvirdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhr
yglqqrlaphtplarvfsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsv
dvsddpsgfrrrvavavdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfl
lqlggiralgyspelvtavradgvviteplagtralgrgpaidrlarddlesnskeiveh
aisvrssleeitdiaepgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfp
avtasgipkaagveaifrldecprglysgavvmlsadggldaaltlraayqvggrtwlra
gagiieeseperefeetceklstltpylvar

Timeline for d3vehb_:

• d3vehb_ is new in SCOPe 2.02-stable
  
• d3vehb_ appears in SCOPe 2.03
  
• d3vehb_ appears in the current release, SCOPe 2.08, called d3vehb1