SCOPe 2.05: Domain d3vehc_: 3veh C:

Lineage for d3vehc_ (3veh C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein Salicylate synthase MbtI [143945] (1 species)
   Mycobactin synthetase protein I

7. Species Mycobacterium tuberculosis [TaxId:1773] [143946] (9 PDB entries)
   Uniprot Q7D785 15-449

8. Domain d3vehc_: 3veh C: [195124]
   automated match to d3logb_
   complexed with 0ga, gol, k, peg, scn

Details for d3vehc_

PDB Entry: 3veh, 2 Å

PDB Description: Structure of a M. tuberculosis salicylate synthase, MbtI, in complex with an inhibitor methylAMT

PDB Compounds: (C:) Isochorismate synthase/isochorismate-pyruvate lyase mbtI

SCOPe Domain Sequences for d3vehc_:

Sequence; same for both SEQRES and ATOM records:

>d3vehc_ d.161.1.1 (C:) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi
rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv
fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava
vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv
tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae
pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai
frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee
tceklstltpylvar

Timeline for d3vehc_:

• d3vehc_ first appeared in SCOPe 2.02
  
• d3vehc_ appears in SCOPe 2.04
  
• d3vehc_ appears in SCOPe 2.06
  
• d3vehc_ appears in the current release, SCOPe 2.08