Lineage for d2ylja_ (2ylj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2328533Protein Plant peroxidase [48125] (6 species)
  7. 2328536Species Horseradish (Armoracia rusticana) [TaxId:3704] [48126] (29 PDB entries)
  8. 2328541Domain d2ylja_: 2ylj A: [195122]
    automated match to d1h5ma_
    complexed with act, ca, hem; mutant

Details for d2ylja_

PDB Entry: 2ylj (more details), 1.69 Å

PDB Description: Horse Radish Peroxidase, mutant S167Y
PDB Compounds: (A:) peroxidase c1a

SCOPe Domain Sequences for d2ylja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ylja_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]}
qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalygghtfgknqcrfi
mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
crvvns

SCOPe Domain Coordinates for d2ylja_:

Click to download the PDB-style file with coordinates for d2ylja_.
(The format of our PDB-style files is described here.)

Timeline for d2ylja_: