Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (24 species) not a true protein |
Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries) |
Domain d4dj8c_: 4dj8 C: [195112] Other proteins in same PDB: d4dj8b_, d4dj8d_, d4dj8f_ automated match to d1ti8a1 complexed with nag, sia |
PDB Entry: 4dj8 (more details), 2.8 Å
SCOPe Domain Sequences for d4dj8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dj8c_ b.19.1.2 (C:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]} dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv kqeslllatgmknvpe
Timeline for d4dj8c_: