Lineage for d4dj8c_ (4dj8 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778537Species Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId:680693] [195111] (3 PDB entries)
  8. 1778542Domain d4dj8c_: 4dj8 C: [195112]
    Other proteins in same PDB: d4dj8b_, d4dj8d_, d4dj8f_
    automated match to d1ti8a1
    complexed with nag, sia

Details for d4dj8c_

PDB Entry: 4dj8 (more details), 2.8 Å

PDB Description: structure of the hemagglutinin complexed with 6sln from a highly pathogenic h7n7 influenza virus
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4dj8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dj8c_ b.19.1.2 (C:) automated matches {Influenza a virus (a/netherlands/219/2003(h7n7)) [TaxId: 680693]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlilnpndtvtfsfng
afiapdrasflrgksmgiqsevqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslllatgmknvpe

SCOPe Domain Coordinates for d4dj8c_:

Click to download the PDB-style file with coordinates for d4dj8c_.
(The format of our PDB-style files is described here.)

Timeline for d4dj8c_: