SCOP 1.75: Domain d1dvgb_: 1dvg B:

Lineage for d1dvgb_ (1dvg B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)

6. Protein Heme oxygenase-1 (HO-1) [48615] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48617] (13 PDB entries)
   Uniprot P06762 11-222

8. Domain d1dvgb_: 1dvg B: [19511]
   complexed with hem; mutant

Details for d1dvgb_

PDB Entry: 1dvg, 2.2 Å

PDB Description: crystal structure of rat heme oxygenase-1 in complex with heme; seleleno-methionine derivative, mutated at m51t,m93l,m155l,m191l.

PDB Compounds: (B:) heme oxygenase-1

SCOP Domain Sequences for d1dvgb_:

Sequence; same for both SEQRES and ATOM records:

>d1dvgb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Rat (Rattus norvegicus) [TaxId: 10116]}
sqdlsealkeatkevhiraensefmrnfqkgqvsregfklvtaslyhiytaleeeiernk
qnpvyaplyfpeelhrraaleqdlafwygphwqeaipytpatqhyvkrlhevggthpell
vahaytrylgdlsggqvlkkiaqkalalpssgeglasftfpsidnptkfkqlyrarmntl
eltpevkhrvteeaktafllnielfeelqallte

Timeline for d1dvgb_:

• d1dvgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dvgb_ appears in SCOP 1.73
  
• d1dvgb_ appears in SCOPe 2.01
  
• d1dvgb_ appears in the current release, SCOPe 2.08